PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004515789.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 24044.5 Da    PI: 9.2177
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004515789.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.91e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien+snrqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+s+
  XP_004515789.1  9 KRIENESNRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGKLYEFST 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.226161IPR002100Transcription factor, MADS-box
CDDcd002656.75E-40370No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-32373IPR002100Transcription factor, MADS-box
PfamPF003194.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.37787179IPR002487Transcription factor, K-box
PfamPF014863.3E-2288171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MVRGKTQMKR IENESNRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFST RGKLYEFSTS  60
SINKTVERYQ RKIKDFTLNT KGIQENTQHL KECDNSATKK IEHLELSKRK LLGNELDTCA  120
IDELQQIEEQ IERSLSKIRA RKNQLFREQI EKLREQERYL LEENRHLRDK CRIEQDNELI  180
TESLQGGEVE TELFIGRPER RMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A4e-20369268Myocyte-specific enhancer factor 2A
3kov_B4e-20369268Myocyte-specific enhancer factor 2A
3kov_I4e-20369268Myocyte-specific enhancer factor 2A
3kov_J4e-20369268Myocyte-specific enhancer factor 2A
3mu6_A3e-20369268Myocyte-specific enhancer factor 2A
3mu6_B3e-20369268Myocyte-specific enhancer factor 2A
3mu6_C3e-20369268Myocyte-specific enhancer factor 2A
3mu6_D3e-20369268Myocyte-specific enhancer factor 2A
3p57_A4e-20369268Myocyte-specific enhancer factor 2A
3p57_B4e-20369268Myocyte-specific enhancer factor 2A
3p57_C4e-20369268Myocyte-specific enhancer factor 2A
3p57_D4e-20369268Myocyte-specific enhancer factor 2A
3p57_I4e-20369268Myocyte-specific enhancer factor 2A
3p57_J4e-20369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7380451e-153HQ738045.1 Medicago truncatula isolate L0673C Soc1b gene, partial sequence.
GenBankHQ7380461e-153HQ738046.1 Medicago truncatula isolate L0401C Soc1b gene, partial sequence.
GenBankHQ7380471e-153HQ738047.1 Medicago truncatula isolate L0448B Soc1b gene, partial sequence.
GenBankHQ7380481e-153HQ738048.1 Medicago truncatula isolate L0526C Soc1b gene, partial sequence.
GenBankHQ7380491e-153HQ738049.1 Medicago truncatula isolate L0640C Soc1b gene, partial sequence.
GenBankHQ7380501e-153HQ738050.1 Medicago truncatula isolate L0425C Soc1b gene, partial sequence.
GenBankHQ7380511e-153HQ738051.1 Medicago truncatula isolate L0421B Soc1b gene, partial sequence.
GenBankHQ7380521e-153HQ738052.1 Medicago truncatula isolate L0547B Soc1b gene, partial sequence.
GenBankHQ7380531e-153HQ738053.1 Medicago truncatula isolate L0233C Soc1b gene, partial sequence.
GenBankHQ7380541e-153HQ738054.1 Medicago truncatula isolate L0372B Soc1b gene, partial sequence.
GenBankHQ7380551e-153HQ738055.1 Medicago truncatula isolate L0216B Soc1b gene, partial sequence.
GenBankHQ7380571e-153HQ738057.1 Medicago truncatula isolate L0546B Soc1b gene, partial sequence.
GenBankHQ7380581e-153HQ738058.1 Medicago truncatula isolate L0166B Soc1b gene, partial sequence.
GenBankHQ7380601e-153HQ738060.1 Medicago truncatula isolate L0404B Soc1b gene, partial sequence.
GenBankHQ7380611e-153HQ738061.1 Medicago truncatula isolate L0410B Soc1b gene, partial sequence.
GenBankHQ7380621e-153HQ738062.1 Medicago truncatula isolate L0306C Soc1b gene, partial sequence.
GenBankHQ7380631e-153HQ738063.1 Medicago truncatula isolate L0414C Soc1b gene, partial sequence.
GenBankHQ7380651e-153HQ738065.1 Medicago truncatula isolate L0330B Soc1b gene, partial sequence.
GenBankHQ7380671e-153HQ738067.1 Medicago truncatula isolate L0732D Soc1b gene, partial sequence.
GenBankHQ7380681e-153HQ738068.1 Medicago tornata isolate L0750D Soc1b gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515788.11e-144PREDICTED: agamous-like MADS-box protein AGL19
RefseqXP_004515789.11e-144PREDICTED: agamous-like MADS-box protein AGL19
SwissprotO827433e-75AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLA0A072UQQ31e-105A0A072UQQ3_MEDTR; MADS-box transcription factor
STRINGGLYMA05G03660.82e-99(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-68AGAMOUS-like 19